franklinpharmacyandhealthcare.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
crawl-delay: 30 User-agent: Googlebot User-agent: Slurp User-agent: msnbot User-agent: Mediapartners-Google* User-agent: Googlebot-Image User-agent: Yahoo-MMCrawler User-agent: SemrushBot Disallow: User-agent: * Disallow: / User-agent: * Disallow: /patient-resources/article_modal/ Disallow: /patient-resources/library_modal/ Sitemap: | ||
Meta Tags
| Title | Home | Franklin Pharmacy (330) 369-4567 | Warren, |
| Description | Sign Up Looking for a local pharmacy with a personal touch? Franklin Pharmacy offers traditional quality service with modern-day conveniences. Try us |
| Keywords | pharmacy, prescriptions, prescription refills, cvs, walgreens, walmart, warren, franklin pharmacy, youngstown rd |
Server Information
| WebSite | |
| Host IP | 69.28.70.241 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
franklinpharmacyandhealthcare.com Valuation
|
US$11,074,552
Last updated: 2023-05-14 22:59:03
franklinpharmacyandhealthcare.com has Semrush global rank of 955,732. franklinpharmacyandhealthcare.com has an estimated worth of US$ 11,074,552, based on its estimated Ads revenue. franklinpharmacyandhealthcare.com receives approximately 1,277,833 unique visitors each day. Its web server is located in United States, with IP address 69.28.70.241. According to SiteAdvisor, franklinpharmacyandhealthcare.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$11,074,552 |
| Daily Ads Revenue | US$10,223 |
| Monthly Ads Revenue | US$306,680 |
| Yearly Ads Revenue | US$3,680,159 |
| Daily Unique Visitors | 85,189 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| franklinpharmacyandhealthcare.com. 3599 | A | IP: 69.28.70.241 | |
| franklinpharmacyandhealthcare.com. 3600 | NS | NS Record: ns3.quickroutedns.com. | |
| franklinpharmacyandhealthcare.com. 3600 | NS | NS Record: ns2.quickroutedns.com. | |
| franklinpharmacyandhealthcare.com. 3600 | NS | NS Record: ns1.quickroutedns.com. | |
| franklinpharmacyandhealthcare.com. 3600 | MX | MX Record: 10 mail.mysecurescripts.com. |
HtmlToTextCheckTime:2023-05-14 22:59:03
| ===--> We offer Free Covid Saliva Testing, free local deliveries and free med set packaging. Toggle navigation My Pharmacy About Us Services Sign Up Today! New Patient Transfer Prescriptions New Prescriptions Patient Resources Recent Health News Pill Identifier Drug Search COVID-19 Services Contact Contact Location / Hours Help Franklin Pharmacy 1732 Youngstown Road SoutheastWarren, OH 44484 (330) 369-4567 (330) 369-8443 Warren’s Only Independent Drug Store 2023 © All Rights Reserved. Privacy Policy Languages English Español Help Pill Identifier Quick Refill Location / Hours Sign Up Today! Login Stay Healthy We’re here to help! Patient Resources Manage your family’s medication under one account! Register Today! Birthday, Anniversary or Special Celebration? We’ve got a card for that! Manage your facility’s patient medications in one account! Contact Us Ask our friendly staff about our text and email notification service! Your health is our priority . We take our role in your health |
HTTP Headers
HTTP/1.1 301 Moved Permanently Date: Fri, 24 Dec 2021 04:11:25 GMT Server: Apache Location: https://franklinpharmacyandhealthcare.com/ Cache-Control: max-age=604800 Expires: Fri, 31 Dec 2021 04:11:25 GMT Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 200 OK Date: Fri, 24 Dec 2021 04:11:25 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=26860b45994b281b459bda3ee04765f2; path=/; secure; HttpOnly; SameSite=None; Secure Set-Cookie: mobile_app=true; expires=Sat, 25-Dec-2021 04:11:25 GMT; Max-Age=86400; SameSite=None; Secure Content-Type: text/html; charset=UTF-8 |
franklinpharmacyandhealthcare.com Whois Information
Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM Registry Domain ID: 102119557_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: http://www.enomdomains.com Updated Date: 2021-07-17T07:57:05Z Creation Date: 2003-08-15T17:33:18Z Registry Expiry Date: 2022-08-15T17:33:18Z Registrar: eNom, LLC Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1.QUICKROUTEDNS.COM Name Server: NS2.QUICKROUTEDNS.COM Name Server: NS3.QUICKROUTEDNS.COM DNSSEC: unsigned >>> Last update of whois database: 2021-12-27T12:06:23Z <<< |